toonpool logo
  • Agent
  • Koleksiyonlar
  • devamı
    • Topluluk
    • Üyeler
    • Özel arama
    • Yardım
  • Giris yap




    • Password lost?
  • Kaydol
  • türkçe
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Yeni Karikatürler
Cartoon: wahlarena merkel (medium) by leopold maurer tagged wahlarena,fragen,wahlkampf,merkel,schulz,bundestagswahl,tv,langeweile,einschläfernd,wiegenlied,schlaflied,publikum,leopold,maurer,karikatur,cartoon,wahlarena,fragen,wahlkampf,merkel,schulz,bundestagswahl,tv,langeweile,einschläfernd,wiegenlied,schlaflied,publikum,leopold,maurer,karikatur,cartoon

wahlarena merkel

#299424 / 4108 kez izlendi
leopold maurer yapan leopold maurer
tarih 11. September 2017
rating-star 3
Applause
favorite
Favori
report spam
Report

...

Politika »  National/Domestic  International  Elections  Military & Security  Taxes  Third World  Terrorism  Finances  Pension  Economy & Money  Technology  Environment  Health  Family & Youth  Education  Confederations  Jobs & Social  Immigration  Fraud & Corruption  Historical  Other  Conflicts & War  Politicians  Parties  Privacy & Customer  Democracy  Energy

wahlarenafragenwahlkampfmerkelschulzbundestagswahltvlangeweileeinschläferndwiegenliedschlafliedpublikumleopoldmaurerkarikaturcartoonwahlarenafragenwahlkampfmerkelschulzbundestagswahltvlangeweileeinschläferndwiegenliedschlafliedpublikumleopoldmaurerkarikaturcartoon

Yorumlar (2)

 
Harm Bengen
Member
der mann im mond haut zu.

Harm Bengen, tarih 11. September 2017  report post  cevap ver applause 0

 
RABE
Member
Dark Side Of The Moon!*****

RABE, tarih 11. September 2017  report post  cevap ver applause 0

 
 

Yorum ekle
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Sanatcı üzerine bilgi leopold maurer


Cartoon: Merkel zieht Corona-Bilanz (small) by leopold maurer tagged merkel,pandemie,corona,digitalisierung,bürokratisierung,bilanz,deutschland,world,economic,forum,telekonferenz,videokonferenz,verbindung,abgebrochen,wirtschaft
Merkel zieht Corona-Bilanz
Cartoon: Omikron (small) by leopold maurer tagged virus,pandemie,corona,covid,sars,19,mutation,omikron,delta,ansteckend,schnell,protein,spike,rotkäppchen,impfung
Omikron
Cartoon: Trump unterzeichnet Dekrete (small) by leopold maurer tagged trump,präsident,47,usa,dekrete,vorhaben,amtszeit,demokratie,kehrtwende,ausstieg,who,klimabündnis,grenze,migranten,migrantinnen,begnadigungen,donald,golf,leopold,maurer,cartoon,karikatur
Trump unterzeichnet Dekrete
  • Service

  • ToonAgent
  • Yardım
  • FAQ
  • Daily Toon
  • Hakkımızda

  • Hakkımızda
  • Iletişim
  • Genel Koşullar
  • Gizlilik
  • Manage cookies
  • Topluluk

  • Topluluk
  • Özel arama
  • Koleksiyonlar
  • Kaydol
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.