toonpool logo
  • Agent
  • Koleksiyonlar
  • devamı
    • Topluluk
    • Üyeler
    • Özel arama
    • Yardım
  • Giris yap




    • Password lost?
  • Kaydol
  • türkçe
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Yeni Karikatürler
Cartoon: Wertschöpfungskette (medium) by Erwin Pischel tagged wertschoepfungskette,corona,pandemie,sars,cov,epidemie,wertkette,kettenreaktion,value,chain,produktion,werte,wertschoepfung,betriebswirtschaft,marketing,vertrieb,wuhan,china,viren,schuppentier,artensterben,tierart,pischel,global,mitteltemperatur,klimaschutz,organigramm,temperatur,rezession,wirtschaft,kohlendioxid,kohlenstoffdioxid

Wertschöpfungskette

#354391 / 3978 kez izlendi
Erwin Pischel yapan Erwin Pischel
tarih 13. March 2020
rating-star 0
Applause
favorite
Favori
report spam
Report

Geht doch!

Doğa »  Environment  Evolution  Animals  Endangered Animals  Planet Earth  Climate  Natural Disasters  Nature Protection  Epidemics  Microbiology  Human  Genetics

wertschoepfungskettecoronapandemiesarscovepidemiewertkettekettenreaktionvaluechainproduktionwertewertschoepfungbetriebswirtschaftmarketingvertriebwuhanchinavirenschuppentierartensterbentierartpischelglobalmitteltemperaturklimaschutzorganigrammtemperaturrezessionwirtschaftkohlendioxidkohlenstoffdioxid

Yorumlar (0)

Yorum ekle  
 

Sanatcı üzerine bilgi Erwin Pischel


Cartoon: Leben im Überfluss (small) by Erwin Pischel tagged leben,überfluss,zahn,zahnpasta,zahnbürste,zahnreinigung,reinigung,verschwendung,pasta,creme,zahncreme,übermaß,sparsamkeit,sparen,pischel
Leben im Überfluss
Cartoon: Konkrete Poesie Sammlung (small) by Erwin Pischel tagged konkrete,poesie,sammlung,pischel
Konkrete Poesie Sammlung
Cartoon: Ernährungsumstellung (small) by Erwin Pischel tagged ernährungsumstellung,ernährung,nutrition,essen,essensplan,ernährungsplan,stoffwechsel,stoffwechseltyp,nährstoffe,mikronährstoffe,gesundheit,gesund,ungesund,körper,körpergewicht,gewichtszunahme,diät,aussehen,outfit,schlank,schlankheit,dick,dicksein,wohlbefinden,konsum,lebensmittel,verdauung,eisbein,haxe,hachse,haxn,hämchen,haspel,bötel,knöchla,stelze,wädli,fleischgericht,schwein,fett,kohlenhydrat,eiweiß,protein,vegan,kuchen,sahnetorte,sahne,torte,süßigkeit,kommunikation,frage,höflichkeit,pischel
Ernährungsumstellung
  • Service

  • ToonAgent
  • Yardım
  • FAQ
  • Daily Toon
  • Hakkımızda

  • Hakkımızda
  • Iletişim
  • Genel Koşullar
  • Gizlilik
  • Manage cookies
  • Topluluk

  • Topluluk
  • Özel arama
  • Koleksiyonlar
  • Kaydol
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.