toonpool logo
  • Agent
  • Koleksiyonlar
  • devamı
    • Topluluk
    • Üyeler
    • Özel arama
    • Yardım
  • Giris yap




    • Password lost?
  • Kaydol
  • türkçe
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Yeni Karikatürler
Cartoon: Trump und Kuba (medium) by leopold maurer tagged trump,usa,präsident,krieg,venezuela,iran,kanada,kuba,grönland,aussenpolitik,innenpolitik,ablenkung,strategie,militär,macht,öl,schock,spritpreise,weltwirtschaft,zerstörer,kind,spiel,langeweile,epstein,files,midterm,wahlen,leopold,maurer,karikatur,cartoon,trump,usa,präsident,krieg,venezuela,iran,kanada,kuba,grönland,aussenpolitik,innenpolitik,ablenkung,strategie,militär,macht,öl,schock,spritpreise,weltwirtschaft,zerstörer,kind,spiel,langeweile,epstein,files,midterm,wahlen,leopold,maurer,karikatur,cartoon

Trump und Kuba

#480940 / 1549 kez izlendi
leopold maurer yapan leopold maurer
tarih 17. March 2026
rating-star 10
Applause
favorite
Favori
report spam
Report

...

Politika »  National/Domestic  International

trumpusapräsidentkriegvenezuelairankanadakubagrönlandaussenpolitikinnenpolitikablenkungstrategiemilitärmachtölschockspritpreiseweltwirtschaftzerstörerkindspiellangeweileepsteinfilesmidtermwahlenleopoldmaurerkarikaturcartoontrumpusapräsidentkriegvenezuelairankanadakubagrönlandaussenpolitikinnenpolitikablenkungstrategiemilitärmachtölschockspritpreiseweltwirtschaftzerstörerkindspiellangeweileepsteinfilesmidtermwahlenleopoldmaurerkarikaturcartoon

Yorumlar (7)

Yorum ekle  
Harm Bengen
Member
wenn er wenigstens in der gummizelle spielen würde.

Harm Bengen, tarih 18. March 2026  report post  cevap ver applause 0

 
omoko
Member
Sind so kleine Hände.

omoko, tarih 17. March 2026  report post  cevap ver applause 0

 
markus-grolik
Member
Gamification

markus-grolik, tarih 17. March 2026  report post  cevap ver applause 0

 
zenundsenf
Member
es geht auf ein seltsames grande finale zu!
(fragt sich für wen?)

zenundsenf, tarih 17. March 2026  report post  cevap ver applause 0

 
Erl
Member
Der ist doch spielsüchtig!

Erl, tarih 17. March 2026  report post  cevap ver applause 0

 
Barthold
Member
Bub, eindeutig Symptome von Wohlstandsverwahrlosung zeigend . . .

Barthold, tarih 17. March 2026  report post  cevap ver applause 0

 
MorituruS
Member
Aus der Spielesammlung für Leute mit Aufmerksamkeitsdefizit und für Kinder unter 3 Jahren - auch geeignet für komplette Hornochsen.

MorituruS, tarih 17. March 2026  report post  cevap ver applause 0

 
 

Yorum ekle
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Sanatcı üzerine bilgi leopold maurer


Cartoon: Exportstopp Astrazeneca (small) by leopold maurer tagged exportstopp,eu,astrazeneca,impfstoffe,lieferbeschränkungen,großbritannien,suezkanal,havarie,blockade,ärmelkanal,leopold,maurer,karikatur,cartoon,comic,illustration,pandemie,covid,corona,2021
Exportstopp Astrazeneca
Cartoon: Deutschland in der Krise (small) by leopold maurer tagged deutschland,krise,dfb,fussball,haushaltssperre,finanzen,schulden,ampel,regierung,gruene,spd,fdp,haushalt,cdu,csu,afd,umfragen,angst,oesterreich,leopold,maurer,cartoon,karikatur
Deutschland in der Krise
Cartoon: 2G in Österreich (small) by leopold maurer tagged österreich,inzidenz,corona,covid,genesen,geimpft,test,pcr,antigen,frisör,gasthaus,theater,impfung,impfgegner,impfverweigerer,hospitalisiert,intensivstation,jodeln
2G in Österreich
  • Service

  • ToonAgent
  • Yardım
  • FAQ
  • Daily Toon
  • Hakkımızda

  • Hakkımızda
  • Iletişim
  • Genel Koşullar
  • Gizlilik
  • Manage cookies
  • Topluluk

  • Topluluk
  • Özel arama
  • Koleksiyonlar
  • Kaydol
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.