toonpool logo
  • Agent
  • Koleksiyonlar
  • devamı
    • Topluluk
    • Üyeler
    • Özel arama
    • Yardım
  • Giris yap




    • Password lost?
  • Kaydol
  • türkçe
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Yeni Karikatürler
Cartoon: Internationales Plastikabkommen (medium) by leopold maurer tagged uno,plastikabkommen,verringerung,verseuchung,mikroplastik,tierwelt,meer,menschen,organe,berge,luft,welt,flasche,kappe,deckel,verschluss,recycling,verrotung,unverrotbar,leopold,maurer,cartoon,karikatur,uno,plastikabkommen,verringerung,verseuchung,mikroplastik,tierwelt,meer,menschen,organe,berge,luft,welt,flasche,kappe,deckel,verschluss,recycling,verrotung,unverrotbar,leopold,maurer,cartoon,karikatur

Internationales Plastikabkommen

#468442 / 765 kez izlendi
leopold maurer yapan leopold maurer
tarih 05. August 2025
rating-star 4
Applause
favorite
Favori
report spam
Report

--

Politika »  National/Domestic  International

unoplastikabkommenverringerungverseuchungmikroplastiktierweltmeermenschenorganebergeluftweltflaschekappedeckelverschlussrecyclingverrotungunverrotbarleopoldmaurercartoonkarikaturunoplastikabkommenverringerungverseuchungmikroplastiktierweltmeermenschenorganebergeluftweltflaschekappedeckelverschlussrecyclingverrotungunverrotbarleopoldmaurercartoonkarikatur

Yorumlar (3)

 
Barthold
Member
es steht sehr schlecht um der Erde Befinden . . .

Barthold, tarih 06. August 2025  report post  cevap ver applause 0

 
Rovey
Member
Man muss halt Prioritäten setzen.

Rovey, tarih 05. August 2025  report post  cevap ver applause 0

 
Erl
Member
Mondenmund tut Wahrheit kund.

Erl, tarih 05. August 2025  report post  cevap ver applause 0

 
 

Yorum ekle
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Sanatcı üzerine bilgi leopold maurer


Cartoon: Rezession (small) by leopold maurer tagged habeck,ampel,regierung,minister,wirtschaft,rezession,konjunkturprognose,nobelpreis,protein,verleihung,traum,loesung,problem,leopold,maurer,karikatur,cartoon
Rezession
Cartoon: ausserirdischer spätzünder (small) by leopold maurer tagged erde,welt,global,klima,wirtschaftswachstum,reich,arm,zerstörung,soziale,spannung,ufo,alien,bösewicht,plan
ausserirdischer spätzünder
Cartoon: General im Krisenstab (small) by leopold maurer tagged general,krisenstab,corona,covic,sars,cov,pandemie,massnahmen,impfung,booster,megafon,disziplin,soldat,bundeswehr
General im Krisenstab
  • Service

  • ToonAgent
  • Yardım
  • FAQ
  • Daily Toon
  • Hakkımızda

  • Hakkımızda
  • Iletişim
  • Genel Koşullar
  • Gizlilik
  • Manage cookies
  • Topluluk

  • Topluluk
  • Özel arama
  • Koleksiyonlar
  • Kaydol
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.