toonpool logo
  • Agent
  • Koleksiyonlar
  • devamı
    • Topluluk
    • Üyeler
    • Özel arama
    • Yardım
  • Giris yap




    • Password lost?
  • Kaydol
  • türkçe
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Yeni Karikatürler
Cartoon: Children and war (medium) by Enrico Bertuccioli tagged war,victims,children,safety,security,political,life,death,humanbeings,bloodshed,humanrights,conflict,bombing,emergency,destruction,casualties,civilian,protection,mental,stress,anxiety,care,health,supports,war,victims,children,safety,security,political,life,death,humanbeings,bloodshed,humanrights,conflict,bombing,emergency,destruction,casualties,civilian,protection,mental,stress,anxiety,care,health,supports

Children and war

#412192 / 2128 kez izlendi
Enrico Bertuccioli yapan Enrico Bertuccioli
tarih 05. September 2022
rating-star 2
Applause
favorite
Favori
report spam
Report

Defenceless victims...

Politika »  National/Domestic  International  Military & Security  Terrorism  Technology  Environment  Health  Family & Youth  Education  Jobs & Social  Immigration  Historical  Other  Conflicts & War  Politicians  Parties

warvictimschildrensafetysecuritypoliticallifedeathhumanbeingsbloodshedhumanrightsconflictbombingemergencydestructioncasualtiescivilianprotectionmentalstressanxietycarehealthsupportswarvictimschildrensafetysecuritypoliticallifedeathhumanbeingsbloodshedhumanrightsconflictbombingemergencydestructioncasualtiescivilianprotectionmentalstressanxietycarehealthsupports

Yorumlar (0)

Yorum ekle  
 

Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Sanatcı üzerine bilgi Enrico Bertuccioli


Cartoon: The Czar (small) by Enrico Bertuccioli tagged putinvladimir,putin,russia,president,presidentialelections,elections,government,authocracy,authoritarianism,dictatorship,democracy,leader,leadership,power,control,nationalism,politicalcartoon,editorialcartoon
The Czar
Cartoon: Integration (small) by Enrico Bertuccioli tagged integration,immigration,farrightextremism,farright,migrants,migrantcrisis,politicalextremism,intolerance,racism,extrem,right,religiousextremism,political,violence,money,business,politicalcartoon,editorialcartoon,migrantsmuggling,humantrafficking
Integration
Cartoon: The claw of big tech (small) by Enrico Bertuccioli tagged world,newworldorder,technology,bigtech,technologicaldomain,domain,data,bigdata,power,control,neocapitalism,capitalism,technologicalcapitalism,digital,digitalcapitalism,money,business,economy,greed,dictatorship,political,politicalcartoon,editorialcartoon
The claw of big tech
  • Service

  • ToonAgent
  • Yardım
  • FAQ
  • Daily Toon
  • Hakkımızda

  • Hakkımızda
  • Iletişim
  • Genel Koşullar
  • Gizlilik
  • Manage cookies
  • Topluluk

  • Topluluk
  • Özel arama
  • Koleksiyonlar
  • Kaydol
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2025 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data ( e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

Necessary Cookies: These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
Personalisation Cookies: These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
Convenience Cookies: These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
Analysis Cookies: These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.