toonpool logo
  • Agent
  • Koleksiyonlar
  • devamı
    • Topluluk
    • Üyeler
    • Özel arama
    • Yardım
  • Giris yap




    • Password lost?
  • Kaydol
  • türkçe
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲

Welcome to toonpool.com,


world's largest community for cartoons, caricatures and fun drawings.

Browse 404453 artworks, discover unique items.

rightleftCartoons » Yeni Karikatürler
Cartoon: Bei Datteln und Feigen (medium) by KI-Vossy tagged frankreich,paris,eu,sarkozy,bruni,lybien,gaddafi,prozess,haftstrafe,gefängnis,wahlkampf,spenden,spendengelder,berufung,korruption,früchte,datteln,feigen,knast,frankreich,paris,eu,sarkozy,bruni,lybien,gaddafi,prozess,haftstrafe,gefängnis,wahlkampf,spenden,spendengelder,berufung,korruption,früchte,datteln,feigen,knast

Bei Datteln und Feigen

#471165 / 751 kez izlendi
KI-Vossy yapan KI-Vossy
tarih 25. September 2025
rating-star 6
Applause
favorite
Favori
report spam
Report

Frankreichs früherer Präsident Nicolas Sarkozy ist im Prozess um angebliche Wahlkampfgelder aus Libyen zu einer fünfjährigen Haftstrafe verurteilt worden. Er will in Berufung gehen: „Ich werde erhobenen Hauptes im Gefängnis schlafen“, sagte Sarkozy. Und wohl von libyschen Früchten träumen.

Politika »  National/Domestic  International  Elections  Finances  Economy & Money  Confederations  Fraud & Corruption  Historical  Other  Politicians  Parties  Democracy

frankreichpariseusarkozybrunilybiengaddafiprozesshaftstrafegefängniswahlkampfspendenspendengelderberufungkorruptionfrüchtedattelnfeigenknastfrankreichpariseusarkozybrunilybiengaddafiprozesshaftstrafegefängniswahlkampfspendenspendengelderberufungkorruptionfrüchtedattelnfeigenknast

Collections

(1)
Political Cartoons - International!

Yorumlar (2)

 
MorituruS
Member
Da beißt er auf des Lebens härtesten Dattelkern!

MorituruS, tarih 26. September 2025  report post  cevap ver applause 0

 
ArtyFicial
Member
Bon appetit!

ArtyFicial, tarih 25. September 2025  report post  cevap ver applause 0

 
 

Yorum ekle
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Sanatcı üzerine bilgi KI-Vossy


Cartoon: Frusthansa (small) by KI-Vossy tagged lufthansa,jobs,streichen,entlassen,entlassungen,frusthans,pilot,piloten,fluggesellschaft,stellenstreichungen,kurzstecke,flotte,flugzeuge,jets,jet,flugzeug,fliegen,urlaub,ticket,ticketpreise,cityline,turbulenzen,frust
Frusthansa
Cartoon: Chatland 12 points (small) by KI-Vossy tagged esc,gema,chatgpt,musik,künstler,openai,landgericht,münchen,urtei,urheberrecht,urheberrechtsverletzung,urheber,ki,geschützte,werke,kreativ,chatland,ai,intelligenz,künstliche
Chatland 12 points
Cartoon: Unaussprechlich (small) by KI-Vossy tagged buchstaben,wales,ortsname,europa,urlaub,tld,domain,guiness,llanfair
Unaussprechlich
  • Service

  • ToonAgent
  • Yardım
  • FAQ
  • Daily Toon
  • Hakkımızda

  • Hakkımızda
  • Iletişim
  • Genel Koşullar
  • Gizlilik
  • Manage cookies
  • Topluluk

  • Topluluk
  • Özel arama
  • Koleksiyonlar
  • Kaydol
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.