toonpool logo
  • Agent
  • Koleksiyonlar
  • devamı
    • Topluluk
    • Üyeler
    • Özel arama
    • Yardım
  • Giris yap




    • Password lost?
  • Kaydol
  • türkçe
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Yeni Karikatürler
Cartoon: 20211207-KeineImpfpflicht (medium) by Marcus Gottfried tagged impfung,impfpflicht,corona,covid,querdenker,weihnachten,weihnachtsmann,impfung,impfpflicht,corona,covid,querdenker,weihnachten,weihnachtsmann

20211207-KeineImpfpflicht

#396351 / 3428 kez izlendi
Marcus Gottfried yapan Marcus Gottfried
tarih 13. December 2021
rating-star 3
Applause
favorite
Favori
report spam
Report

.

Politika

impfungimpfpflichtcoronacovidquerdenkerweihnachtenweihnachtsmannimpfungimpfpflichtcoronacovidquerdenkerweihnachtenweihnachtsmann

Collections

(1)
Santa

Yorumlar (2)

 
Harm Bengen
Member
keine lösung, aber immerhin ein anfang.

Harm Bengen, tarih 13. December 2021  report post  cevap ver applause 0

 
RABE
Member
Gewaltiger Irrtum...*****

RABE, tarih 13. December 2021  report post  cevap ver applause 0

 
 

Yorum ekle
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Sanatcı üzerine bilgi Marcus Gottfried


Cartoon: Bewerbung schreiben (small) by Marcus Gottfried tagged bundespräsident,gauch,präsident,wahl,alter,staatsspitze,damen,frau,frauenquote,altersdurchschnitt,demographie,schreiben,abgeben,vorfreude,veränderung,freude,marcus,gottfried,cartoon,karikatur
Bewerbung schreiben
Cartoon: 20210427-TestenLassen (small) by Marcus Gottfried tagged corona,covid,test,infektion,pcr,antigen,baumarkt,lockdown,click,an,meet
20210427-TestenLassen
Cartoon: Nicht lieferbar (small) by Marcus Gottfried tagged karlsruhe,esm,urteil,klage,bundesverfassungsgericht,europa,krise,rüstung,export,panzer,lieferung,geschäfte,aufstand,widerstand,demokratie
Nicht lieferbar
  • Service

  • ToonAgent
  • Yardım
  • FAQ
  • Daily Toon
  • Hakkımızda

  • Hakkımızda
  • Iletişim
  • Genel Koşullar
  • Gizlilik
  • Manage cookies
  • Topluluk

  • Topluluk
  • Özel arama
  • Koleksiyonlar
  • Kaydol
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.