toonpool logo
  • Agent
  • Koleksiyonlar
  • devamı
    • Topluluk
    • Üyeler
    • Özel arama
    • Yardım
  • Giris yap




    • Password lost?
  • Kaydol
  • türkçe
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Yeni Karikatürler
Cartoon: Spanisches Winnergate (medium) by Erwin Pischel tagged spanien,england,final,finale,uefa,euro,2024,southgate,winner,gewinner,sieger,verlierer,fußball,football,soccer,three,lions,furia,roja,europameisterschaft,championship,trophäe,cup,pokal,titel,sehnsucht,warten,erlösung,heilserwartung,erlösungserwartung,scheitern,trainer,mannschaft,yamal,kane,triumph,turniersieg,turnier,wettkampf,kampfspiel,erster,zweiter,vize,pischel

Spanisches Winnergate

#447175 / 1011 kez izlendi
Erwin Pischel yapan Erwin Pischel
tarih 14. July 2024
rating-star 1
Applause
favorite
Favori
report spam
Report

Peter Ustinov: Der englische Spieler ist stolz darauf, ein guter Verlierer zu sein. Dadurch erreicht er, dass seine Gegner sich schuldig fühlen, wenn sie gewonnen haben.

Spor »  Soccer/Football  Ball Sports  Championships

spanienenglandfinalfinaleuefaeuro2024southgatewinnergewinnersiegerverliererfußballfootballsoccerthreelionsfuriarojaeuropameisterschaftchampionshiptrophäecuppokaltitelsehnsuchtwartenerlösungheilserwartungerlösungserwartungscheiterntrainermannschaftyamalkanetriumphturniersiegturnierwettkampfkampfspielersterzweitervizepischel

Yorumlar (0)

Yorum ekle  
 

Sanatcı üzerine bilgi Erwin Pischel


Cartoon: Augenschmaus (small) by Erwin Pischel tagged auge,augenschmaus,teller,essen,gericht,mahlzeit,pischel
Augenschmaus
Cartoon: Notopfer Corona Steuermarke (small) by Erwin Pischel tagged notopfer,briefmarke,corona,deutschland,postwertzeichen,postporto,porto,michelkatalog,postsendung,berlinblockade,berlin,blockade,westberlin,brief,postkarte,wirtschaft,not,verschuldung,staat,wirtschaftsministerium,sarc,covid,virus,spike,protein,pandemie,epidemie,schulden,staatsverschuldung,milliarden,euro,cent,pischel,kredit
Notopfer Corona Steuermarke
Cartoon: Selbstevaluation (small) by Erwin Pischel tagged selbstevaluation,evaluation,kanne,teekanne,kaffeekanne,haus,fenster,öffnung,operation
Selbstevaluation
  • Service

  • ToonAgent
  • Yardım
  • FAQ
  • Daily Toon
  • Hakkımızda

  • Hakkımızda
  • Iletişim
  • Genel Koşullar
  • Gizlilik
  • Manage cookies
  • Topluluk

  • Topluluk
  • Özel arama
  • Koleksiyonlar
  • Kaydol
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2025 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data ( e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

Necessary Cookies: These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
Personalisation Cookies: These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
Convenience Cookies: These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
Analysis Cookies: These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.