toonpool logo
  • Agent
  • Koleksiyonlar
  • devamı
    • Topluluk
    • Üyeler
    • Özel arama
    • Yardım
  • Giris yap




    • Password lost?
  • Kaydol
  • türkçe
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Yeni Karikatürler
Cartoon: ...full strike... (medium) by markus-grolik tagged gdl,bahn,bahnstreik,lokführer,geld,macht,gewerkschaft,gewerkschaftskampf,zug,schlager,hitparade,zdf,grolik,gdl,bahn,bahnstreik,lokführer,geld,macht,gewerkschaft,gewerkschaftskampf,zug,schlager,hitparade,zdf,grolik

...full strike...

#247859 / 3866 kez izlendi
markus-grolik yapan markus-grolik
tarih 20. May 2015
rating-star 8
Applause
favorite
Favori
report spam
Report

Christian Anders versus Weselsky

Ekonomi »  Financial Crisis  Managers  Salaries  Job & Employment  Career  Money & Credits  Trade & Sale  Insurances  Labor Unions  Economic Cycle  Energy & Resources  Communication  Ecology  Gastronomy & Leisure  Tourism  Poverty & Welfare  Ads & Marketing

gdlbahnbahnstreiklokführergeldmachtgewerkschaftgewerkschaftskampfzugschlagerhitparadezdfgrolikgdlbahnbahnstreiklokführergeldmachtgewerkschaftgewerkschaftskampfzugschlagerhitparadezdfgrolik

Yorumlar (5)

 
Jori Niggemeyer
Member
im hirn des einen ein luftzug, im hirn des anderen zugluft!!

Jori Niggemeyer, tarih 26. June 2015  report post  cevap ver applause 0

 
Erl
Member
Er ist anders.

Erl, tarih 22. May 2015  report post  cevap ver applause 0

 
RABE
Member
Schlagerschienenersatzverkehr *****

RABE, tarih 21. May 2015  report post  cevap ver applause 0

 
Andreas Prüstel
Member
zug um zug.

Andreas Prüstel, tarih 20. May 2015  report post  cevap ver applause 0

 
Harm Bengen
Member
durchzug.

Harm Bengen, tarih 20. May 2015  report post  cevap ver applause 0

 
 

Yorum ekle
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Sanatcı üzerine bilgi markus-grolik


Cartoon: Green Wasching... (small) by markus-grolik tagged klima,klimawandel,klimaneutral,greenwashing,konsum,produktion,umweltverschmutzung,eu,europa,label,siegel
Green Wasching...
Cartoon: Olympischer Gedanke... (small) by markus-grolik tagged olympia,ehrgeiz,sport,rekorde,höchstleistung,profisport,gewinner,verlierer,paris,ioc,wettbewerb,spiele,spielen
Olympischer Gedanke...
Cartoon: Mangelverwaltung (small) by markus-grolik tagged priorisierung,pcr,test,mangel,corona,antigen,schnelltest,lauterbach,expertenrat,gesundheitsminister,regeln,massnahmen,omikron,chaos,deutschland
Mangelverwaltung
  • Service

  • ToonAgent
  • Yardım
  • FAQ
  • Daily Toon
  • Hakkımızda

  • Hakkımızda
  • Iletişim
  • Genel Koşullar
  • Gizlilik
  • Manage cookies
  • Topluluk

  • Topluluk
  • Özel arama
  • Koleksiyonlar
  • Kaydol
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2025 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.